PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00196.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 366aa    MW: 40399.6 Da    PI: 5.8382
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00196.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.54.9e-07444539
                 zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                             +C+ ++e++   +C+++  +lC +C  ++H+       H++
  Rsa1.0_00196.1_g00015.1  4 MCDFCGEQRSMVYCRSDAACLCLSCDRSIHSAnalskrHSR 44
                             6*****************************65677777765 PP

2zf-B_box23.11.6e-074691441
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg........Htvvp 41
                              +C++++ ++++  C + +  lC++C  ++H++        H++++
  Rsa1.0_00196.1_g00015.1 46 LVCERCNAQPATVRCVEERASLCQNCDWSGHNNnnnsstnhHKRQT 91
                             68*****************************888999999888765 PP

3CCT60.84.5e-21309352144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              R++a++RYkeK+k RkF+K++rY+sRKa+A+ R RvKGrF k+ 
  Rsa1.0_00196.1_g00015.1 309 RNNAVMRYKEKKKARKFDKTVRYASRKARADVRRRVKGRFIKAG 352
                              99**************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.712147IPR000315B-box-type zinc finger
CDDcd000211.81E-7447No hitNo description
SMARTSM003365.9E-9447IPR000315B-box-type zinc finger
PROSITE profilePS501199.4284392IPR000315B-box-type zinc finger
CDDcd000214.15E-44773No hitNo description
SMARTSM003360.934892IPR000315B-box-type zinc finger
PfamPF062034.0E-16309351IPR010402CCT domain
PROSITE profilePS5101715.08309351IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGYMCDFCGE QRSMVYCRSD AACLCLSCDR SIHSANALSK RHSRTLVCER CNAQPATVRC  60
VEERASLCQN CDWSGHNNNN NSSTNHHKRQ TISCYSGCPS SSELASIWSF CSDLAGQSVC  120
EQEMGMMNID DDGQTNQNCN EDKKDVVVGS SSRPETSFAA HANSSFVKDV GVCEDDFYDN  180
LGMDEVDLAL ENYEELFGTA FNTSGQLFGQ CGIDSLFQKH NQAAPEGGIS VQPAESNDSF  240
MSSKTEPIIC YTSKPAHSNI SFSGVTGDCS AGDFQECGAS TSMQLLGDPP WYPQTSSHDN  300
NGCSYSVTRN NAVMRYKEKK KARKFDKTVR YASRKARADV RRRVKGRFIK AGEAYDYDPL  360
TPTRSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619988.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_013620050.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_013620144.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_013620212.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE50.0COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A0D3AF430.0A0A0D3AF43_BRAOL; Uncharacterized protein
STRINGBra040020.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16822786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.40.0CONSTANS-like 9